Lineage for d5nblc1 (5nbl C:2-146)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. Protein Actin [53073] (10 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [356542] (1 PDB entry)
  8. Domain d5nblc1: 5nbl C:2-146 [356543]
    Other proteins in same PDB: d5nble_, d5nblf_
    automated match to d1yaga1
    complexed with atp, ca

Details for d5nblc1

PDB Entry: 5nbl (more details), 2.8 Å

PDB Description: crystal structure of the arp4-n-actin(apo-state) heterodimer bound by a nanobody
PDB Compounds: (C:) actin

SCOPe Domain Sequences for d5nblc1:

Sequence, based on SEQRES records: (download)

>d5nblc1 c.55.1.1 (C:2-146) Actin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dsevaalvidngsgmckagfagddapravfpsivgrprhqgimvgmgqkdsyvgdeaqsk
rgiltlrypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtq
imfetfnvpafyvsiqavlslyssg

Sequence, based on observed residues (ATOM records): (download)

>d5nblc1 c.55.1.1 (C:2-146) Actin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dsevaalvidngsgmckagfagddapravfpsivgrprhgqkdsyvgdeaqskrgiltlr
ypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqimfetfn
vpafyvsiqavlslyssg

SCOPe Domain Coordinates for d5nblc1 are not available.

Timeline for d5nblc1:

Domains from same chain:
(mouse over for more information)
d5nblc2
Domains from other chains:
(mouse over for more information)
d5nbld1, d5nbld2, d5nble_, d5nblf_