Lineage for d5nble_ (5nbl E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (22 species)
    not a true protein
  7. 2348290Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries)
  8. 3056433Domain d5nble_: 5nbl E: [356495]
    Other proteins in same PDB: d5nblc1, d5nblc2, d5nbld1, d5nbld2
    automated match to d1mqkh_
    complexed with atp, ca

Details for d5nble_

PDB Entry: 5nbl (more details), 2.8 Å

PDB Description: crystal structure of the arp4-n-actin(apo-state) heterodimer bound by a nanobody
PDB Compounds: (E:) nAct-Nanobody

SCOPe Domain Sequences for d5nble_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nble_ b.1.1.1 (E:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesgggsvqagdslrlsctasgrtftnygmgwfrqapgkerefvaaigrfgfplyy
sdsvkgrftisrdnakttvylqmhnlkpedtaiyfcaarnprataedvsaydywgqgtqv
tv

SCOPe Domain Coordinates for d5nble_:

Click to download the PDB-style file with coordinates for d5nble_.
(The format of our PDB-style files is described here.)

Timeline for d5nble_:

  • d5nble_ is new in SCOPe 2.07-stable