Lineage for d5nblf_ (5nbl F:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Vicugna pacos [TaxId:30538] [189756] (80 PDB entries)
  8. Domain d5nblf_: 5nbl F: [356479]
    Other proteins in same PDB: d5nblc1, d5nblc2, d5nbld1, d5nbld2
    automated match to d1mqkh_
    complexed with atp, ca

Details for d5nblf_

PDB Entry: 5nbl (more details), 2.8 Å

PDB Description: crystal structure of the arp4-n-actin(apo-state) heterodimer bound by a nanobody
PDB Compounds: (F:) nAct-Nanobody

SCOPe Domain Sequences for d5nblf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nblf_ b.1.1.1 (F:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesgggsvqagdslrlsctasgrtftnygmgwfrqapgkerefvaaigrfgfplyy
sdsvkgrftisrdnakttvylqmhnlkpedtaiyfcaarnprataedvsaydywgqgtqv
tvss

SCOPe Domain Coordinates for d5nblf_ are not available.

Timeline for d5nblf_:

Domains from other chains:
(mouse over for more information)
d5nblc1, d5nblc2, d5nbld1, d5nbld2, d5nble_