PDB entry 5nbl

View 5nbl on RCSB PDB site
Description: Crystal structure of the Arp4-N-actin(APO-state) heterodimer bound by a nanobody
Class: hydrolase
Keywords: Nuclear actin, Actin-related-proteins, Chromatin remodeling, Nanobody, INO80, SWR1, NuA4, hydrolase
Deposited on 2017-03-02, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin-related protein 4
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ARP4, ACT3, YJL081C, J1012
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Actin-related protein 4
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ARP4, ACT3, YJL081C, J1012
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: actin
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ACT1, ABY1, END7, YFL039C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nblc1, d5nblc2
  • Chain 'D':
    Compound: actin
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ACT1, ABY1, END7, YFL039C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nbld1, d5nbld2
  • Chain 'E':
    Compound: nAct-Nanobody
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NBL
    Domains in SCOPe 2.07: d5nble_
  • Chain 'F':
    Compound: nAct-Nanobody
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NBL
    Domains in SCOPe 2.07: d5nblf_
  • Chain 'G':
    Compound: Unknown peptide
    Species: Trichoplusia ni [TaxId:7111]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NBL (0-End)
  • Chain 'H':
    Compound: Unknown peptide
    Species: Trichoplusia ni [TaxId:7111]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NBL (0-19)
  • Heterogens: CA, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nblC (C:)
    mdsevaalvidngsgmckagfagddapravfpsivgrprhqgimvgmgqkdsyvgdeaqs
    krgiltlrypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmt
    qimfetfnvpafyvsiqavlslyssgrttgivldsgdgvthvvpiyagfslphailridl
    agrdltdylmkilsergysfsttaereivrdikeklcyvaldfeqemqtaaqsssieksy
    elpdgqvitignerfrapealfhpsvlglesagidqttynsimkcdvdvrkelygnivms
    ggttmfpgiaermqkeitalapssmkvkiiapperkysvwiggsilaslttfqqmwiskq
    eydesgpsivhhkcf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nblC (C:)
    dsevaalvidngsgmckagfagddapravfpsivgrprhgqkdsyvgdeaqskrgiltlr
    ypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqimfetfn
    vpafyvsiqavlslyssgrttgivldsgdgvthvvpiyagfslphailridlagrdltdy
    lmkilsergysfsttaereivrdikeklcyvaldfeqemqtaaqsssieksyelpdgqvi
    tignerfrapealfhpsvlglesagidqttynsimkcdvdvrkelygnivmsggttmfpg
    iaermqkeitalapssmkvkiiapperkysvwiggsilaslttfqqmwiskqeydesgps
    ivhhkc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nblD (D:)
    mdsevaalvidngsgmckagfagddapravfpsivgrprhqgimvgmgqkdsyvgdeaqs
    krgiltlrypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmt
    qimfetfnvpafyvsiqavlslyssgrttgivldsgdgvthvvpiyagfslphailridl
    agrdltdylmkilsergysfsttaereivrdikeklcyvaldfeqemqtaaqsssieksy
    elpdgqvitignerfrapealfhpsvlglesagidqttynsimkcdvdvrkelygnivms
    ggttmfpgiaermqkeitalapssmkvkiiapperkysvwiggsilaslttfqqmwiskq
    eydesgpsivhhkcf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nblD (D:)
    dsevaalvidngsgmckagfagddapravfpsivgrprhgqkdsyvgdeaqskrgiltlr
    ypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqimfetfn
    vpafyvsiqavlslyssgrttgivldsgdgvthvvpiyagfslphailridlagrdltdy
    lmkilsergysfsttaereivrdikeklcyvaldfeqemqtaaqsssieksyelpdgqvi
    tignerfrapealfhpsvlglesagidqttynsimkcdvdvrkelygnivmsggttmfpg
    iaermqkeitalapssmkvkiiapperkysvwiggsilaslttfqqmwiskqeydesgps
    ivhhkc
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5nblE (E:)
    maqvqlvesgggsvqagdslrlsctasgrtftnygmgwfrqapgkerefvaaigrfgfpl
    yysdsvkgrftisrdnakttvylqmhnlkpedtaiyfcaarnprataedvsaydywgqgt
    qvtvsskgssawshpqfekgggsgggsggsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nblE (E:)
    qvqlvesgggsvqagdslrlsctasgrtftnygmgwfrqapgkerefvaaigrfgfplyy
    sdsvkgrftisrdnakttvylqmhnlkpedtaiyfcaarnprataedvsaydywgqgtqv
    tv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5nblF (F:)
    maqvqlvesgggsvqagdslrlsctasgrtftnygmgwfrqapgkerefvaaigrfgfpl
    yysdsvkgrftisrdnakttvylqmhnlkpedtaiyfcaarnprataedvsaydywgqgt
    qvtvsskgssawshpqfekgggsgggsggsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nblF (F:)
    qvqlvesgggsvqagdslrlsctasgrtftnygmgwfrqapgkerefvaaigrfgfplyy
    sdsvkgrftisrdnakttvylqmhnlkpedtaiyfcaarnprataedvsaydywgqgtqv
    tvss
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.