![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
![]() | Protein automated matches [190710] (5 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [356377] (1 PDB entry) |
![]() | Domain d6eblb_: 6ebl B: [356466] Other proteins in same PDB: d6ebla_, d6eblc_, d6eble_, d6eblg_ automated match to d1t1da_ complexed with nap |
PDB Entry: 6ebl (more details), 3 Å
SCOPe Domain Sequences for d6eblb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6eblb_ d.42.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} ccervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdaily yyqsggrlrrpvnvpldifseeirfyelgeeamemfredegy
Timeline for d6eblb_: