Lineage for d6eblg_ (6ebl G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829137Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2829481Protein Voltage-dependent K+ channel beta subunit [51434] (1 species)
  7. 2829482Species Norway rat (Rattus norvegicus) [TaxId:10116] [51435] (12 PDB entries)
  8. 2829502Domain d6eblg_: 6ebl G: [356374]
    Other proteins in same PDB: d6eblb_, d6ebld_, d6eblf_, d6eblh_
    automated match to d3eaua_
    complexed with nap

Details for d6eblg_

PDB Entry: 6ebl (more details), 3 Å

PDB Description: the voltage-activated kv1.2-2.1 paddle chimera channel in lipid nanodiscs, cytosolic domain
PDB Compounds: (G:) Voltage-gated potassium channel subunit beta-2

SCOPe Domain Sequences for d6eblg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eblg_ c.1.7.1 (G:) Voltage-dependent K+ channel beta subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagkae
vvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdvvf
anrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceqae
yhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlkdk
ilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmeniga
iqvlpklsssivheidsilgnkpys

SCOPe Domain Coordinates for d6eblg_:

Click to download the PDB-style file with coordinates for d6eblg_.
(The format of our PDB-style files is described here.)

Timeline for d6eblg_: