PDB entry 6ebl

View 6ebl on RCSB PDB site
Description: The voltage-activated Kv1.2-2.1 paddle chimera channel in lipid nanodiscs, cytosolic domain
Class: membrane protein
Keywords: MEMBRANE PROTEIN, transport protein, potassium channel, lipid nanodisc
Deposited on 2018-08-06, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: EM
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Voltage-gated potassium channel subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Kcnab2, Ckbeta2, Kcnb3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ebla_
  • Chain 'B':
    Compound: Potassium voltage-gated channel subfamily A member 2,Potassium voltage-gated channel subfamily B member 2 chimera
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Kcna2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eblb_
  • Chain 'C':
    Compound: Voltage-gated potassium channel subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Kcnab2, Ckbeta2, Kcnb3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eblc_
  • Chain 'D':
    Compound: Potassium voltage-gated channel subfamily A member 2,Potassium voltage-gated channel subfamily B member 2 chimera
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Kcna2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ebld_
  • Chain 'E':
    Compound: Voltage-gated potassium channel subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Kcnab2, Ckbeta2, Kcnb3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eble_
  • Chain 'F':
    Compound: Potassium voltage-gated channel subfamily A member 2,Potassium voltage-gated channel subfamily B member 2 chimera
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Kcna2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eblf_
  • Chain 'G':
    Compound: Voltage-gated potassium channel subunit beta-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Kcnab2, Ckbeta2, Kcnb3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eblg_
  • Chain 'H':
    Compound: Potassium voltage-gated channel subfamily A member 2,Potassium voltage-gated channel subfamily B member 2 chimera
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Kcna2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eblh_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eblA (A:)
    mvqfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagk
    aevvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdv
    vfanrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceq
    aeyhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlk
    dkilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmeni
    gaiqvlpklsssivheidsilgnkpyskkdyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eblA (A:)
    qfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagkae
    vvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdvvf
    anrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceqae
    yhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlkdk
    ilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmeniga
    iqvlpklsssivheidsilgnkpys
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eblB (B:)
    mahhhhhhhhenlyfqgsmtvatgdpvdeaaahpghpqdtydpeadheccervvinisgl
    rfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyyqsggrlrrpv
    nvpldifseeirfyelgeeamemfredegyikeeerplpenefqrqvwllfeypessgpa
    riiaivsvmvilisivsfcletlpifrdenedmhgggvtfhtysqstigyqqstsftdpf
    fivetlciiwfsfeflvrffacpskagfftnimniidivaiipyyvtifltesnksvlqf
    qnvrrvvqifrimrilrifklsrhskglqilgqtlkasmrelgllifflfigvilfssav
    yfaeaderdsqfpsipdafwwavvsmttvgygdmvpttiggkivgslcaiagvltialpv
    pvivsnfnyfyhretegeeqaqylqvtscpkipsspdlkksrsastisksdymeiqegvn
    nsnedfreenlktanctlantnyvnitkmltdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eblB (B:)
    ccervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdaily
    yyqsggrlrrpvnvpldifseeirfyelgeeamemfredegy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6eblC (C:)
    mvqfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagk
    aevvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdv
    vfanrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceq
    aeyhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlk
    dkilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmeni
    gaiqvlpklsssivheidsilgnkpyskkdyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eblC (C:)
    qfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagkae
    vvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdvvf
    anrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceqae
    yhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlkdk
    ilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmeniga
    iqvlpklsssivheidsilgnkpys
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6eblD (D:)
    mahhhhhhhhenlyfqgsmtvatgdpvdeaaahpghpqdtydpeadheccervvinisgl
    rfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyyqsggrlrrpv
    nvpldifseeirfyelgeeamemfredegyikeeerplpenefqrqvwllfeypessgpa
    riiaivsvmvilisivsfcletlpifrdenedmhgggvtfhtysqstigyqqstsftdpf
    fivetlciiwfsfeflvrffacpskagfftnimniidivaiipyyvtifltesnksvlqf
    qnvrrvvqifrimrilrifklsrhskglqilgqtlkasmrelgllifflfigvilfssav
    yfaeaderdsqfpsipdafwwavvsmttvgygdmvpttiggkivgslcaiagvltialpv
    pvivsnfnyfyhretegeeqaqylqvtscpkipsspdlkksrsastisksdymeiqegvn
    nsnedfreenlktanctlantnyvnitkmltdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eblD (D:)
    ccervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdaily
    yyqsggrlrrpvnvpldifseeirfyelgeeamemfredegy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6eblE (E:)
    mvqfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagk
    aevvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdv
    vfanrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceq
    aeyhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlk
    dkilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmeni
    gaiqvlpklsssivheidsilgnkpyskkdyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eblE (E:)
    qfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagkae
    vvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdvvf
    anrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceqae
    yhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlkdk
    ilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmeniga
    iqvlpklsssivheidsilgnkpys
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6eblF (F:)
    mahhhhhhhhenlyfqgsmtvatgdpvdeaaahpghpqdtydpeadheccervvinisgl
    rfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyyqsggrlrrpv
    nvpldifseeirfyelgeeamemfredegyikeeerplpenefqrqvwllfeypessgpa
    riiaivsvmvilisivsfcletlpifrdenedmhgggvtfhtysqstigyqqstsftdpf
    fivetlciiwfsfeflvrffacpskagfftnimniidivaiipyyvtifltesnksvlqf
    qnvrrvvqifrimrilrifklsrhskglqilgqtlkasmrelgllifflfigvilfssav
    yfaeaderdsqfpsipdafwwavvsmttvgygdmvpttiggkivgslcaiagvltialpv
    pvivsnfnyfyhretegeeqaqylqvtscpkipsspdlkksrsastisksdymeiqegvn
    nsnedfreenlktanctlantnyvnitkmltdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eblF (F:)
    ccervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdaily
    yyqsggrlrrpvnvpldifseeirfyelgeeamemfredegy
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6eblG (G:)
    mvqfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagk
    aevvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdv
    vfanrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceq
    aeyhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlk
    dkilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmeni
    gaiqvlpklsssivheidsilgnkpyskkdyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eblG (G:)
    qfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagkae
    vvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdvvf
    anrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceqae
    yhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlkdk
    ilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmeniga
    iqvlpklsssivheidsilgnkpys
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6eblH (H:)
    mahhhhhhhhenlyfqgsmtvatgdpvdeaaahpghpqdtydpeadheccervvinisgl
    rfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyyqsggrlrrpv
    nvpldifseeirfyelgeeamemfredegyikeeerplpenefqrqvwllfeypessgpa
    riiaivsvmvilisivsfcletlpifrdenedmhgggvtfhtysqstigyqqstsftdpf
    fivetlciiwfsfeflvrffacpskagfftnimniidivaiipyyvtifltesnksvlqf
    qnvrrvvqifrimrilrifklsrhskglqilgqtlkasmrelgllifflfigvilfssav
    yfaeaderdsqfpsipdafwwavvsmttvgygdmvpttiggkivgslcaiagvltialpv
    pvivsnfnyfyhretegeeqaqylqvtscpkipsspdlkksrsastisksdymeiqegvn
    nsnedfreenlktanctlantnyvnitkmltdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eblH (H:)
    ccervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdaily
    yyqsggrlrrpvnvpldifseeirfyelgeeamemfredegy