SCOPe 2.08: Domain d6eblh_: 6ebl H:

Lineage for d6eblh_ (6ebl H:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [356377] (1 PDB entry)

8. Domain d6eblh_: 6ebl H: [356379]
   Other proteins in same PDB: d6ebla_, d6eblc_, d6eble_, d6eblg_
   automated match to d1t1da_
   complexed with nap

Details for d6eblh_

PDB Entry: 6ebl, 3 Å

PDB Description: the voltage-activated kv1.2-2.1 paddle chimera channel in lipid nanodiscs, cytosolic domain

PDB Compounds: (H:) Potassium voltage-gated channel subfamily A member 2,Potassium voltage-gated channel subfamily B member 2 chimera

SCOPe Domain Sequences for d6eblh_:

Sequence; same for both SEQRES and ATOM records:

>d6eblh_ d.42.1.0 (H:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ccervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdaily
yyqsggrlrrpvnvpldifseeirfyelgeeamemfredegy

Timeline for d6eblh_:

• d6eblh_ first appeared in SCOPe 2.07