| Class g: Small proteins [56992] (100 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) ![]() |
| Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins) |
| Protein automated matches [197331] (11 species) not a true protein |
| Species Buthus occitanus [TaxId:539894] [356436] (1 PDB entry) |
| Domain d6atmc1: 6atm C:1-37 [356437] Other proteins in same PDB: d6atmc2 automated match to d1scoa_ |
PDB Entry: 6atm (more details), 2.09 Å
SCOPe Domain Sequences for d6atmc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6atmc1 g.3.7.2 (C:1-37) automated matches {Buthus occitanus [TaxId: 539894]}
gvpinvkcrgsrdcldpckkagmrfgkcinskchctp
Timeline for d6atmc1: