Lineage for d6atmc1 (6atm C:1-37)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030578Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 3030705Protein automated matches [197331] (11 species)
    not a true protein
  7. 3030706Species Buthus occitanus [TaxId:539894] [356436] (1 PDB entry)
  8. 3030707Domain d6atmc1: 6atm C:1-37 [356437]
    Other proteins in same PDB: d6atmc2
    automated match to d1scoa_

Details for d6atmc1

PDB Entry: 6atm (more details), 2.09 Å

PDB Description: exploring cystine dense peptide space to open a unique molecular toolbox
PDB Compounds: (C:) Potassium channel toxin alpha-KTx 3.10

SCOPe Domain Sequences for d6atmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6atmc1 g.3.7.2 (C:1-37) automated matches {Buthus occitanus [TaxId: 539894]}
gvpinvkcrgsrdcldpckkagmrfgkcinskchctp

SCOPe Domain Coordinates for d6atmc1:

Click to download the PDB-style file with coordinates for d6atmc1.
(The format of our PDB-style files is described here.)

Timeline for d6atmc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6atmc2