PDB entry 6atm

View 6atm on RCSB PDB site
Description: Exploring Cystine Dense Peptide Space to Open a Unique Molecular Toolbox
Class: toxin
Keywords: Knottins, Cystine knot, Toxins, TOXIN
Deposited on 2017-08-29, released 2018-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Potassium channel toxin alpha-KTx 3.10
    Species: Buthus occitanus israelis [TaxId:539894]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C908 (2-38)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d6atmc1, d6atmc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6atmC (C:)
    gsgvpinvkcrgsrdcldpckkagmrfgkcinskchctp