SCOPe 2.07: Domain d6atmc1: 6atm C:1-37

Lineage for d6atmc1 (6atm C:1-37)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.7: Scorpion toxin-like [57095] (6 families)

5. Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)

6. Protein automated matches [197331] (11 species)
   not a true protein

7. Species Buthus occitanus [TaxId:539894] [356436] (1 PDB entry)

8. Domain d6atmc1: 6atm C:1-37 [356437]
   Other proteins in same PDB: d6atmc2
   automated match to d1scoa_

Details for d6atmc1

PDB Entry: 6atm, 2.09 Å

PDB Description: exploring cystine dense peptide space to open a unique molecular toolbox

PDB Compounds: (C:) Potassium channel toxin alpha-KTx 3.10

SCOPe Domain Sequences for d6atmc1:

Sequence; same for both SEQRES and ATOM records:

>d6atmc1 g.3.7.2 (C:1-37) automated matches {Buthus occitanus [TaxId: 539894]}
gvpinvkcrgsrdcldpckkagmrfgkcinskchctp

Timeline for d6atmc1:

• d6atmc1 is new in SCOPe 2.07-stable
  
• d6atmc1 appears in the current release, SCOPe 2.08