Lineage for d5z84m_ (5z84 M:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025475Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
    automatically mapped to Pfam PF02285
  5. 3025476Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)
  6. 3025537Protein automated matches [190273] (1 species)
    not a true protein
  7. 3025538Species Cow (Bos taurus) [TaxId:9913] [187065] (26 PDB entries)
  8. 3025571Domain d5z84m_: 5z84 M: [356239]
    Other proteins in same PDB: d5z84a_, d5z84b1, d5z84b2, d5z84c_, d5z84d_, d5z84e_, d5z84f_, d5z84g_, d5z84h_, d5z84i_, d5z84j_, d5z84k_, d5z84l_, d5z84n_, d5z84o1, d5z84o2, d5z84p_, d5z84q_, d5z84r_, d5z84s_, d5z84t_, d5z84u_, d5z84v_, d5z84w_, d5z84x_, d5z84y_
    automated match to d1v54m_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5z84m_

PDB Entry: 5z84 (more details), 1.85 Å

PDB Description: the structure of azide-bound cytochrome c oxidase determined using the crystals exposed to 20 mm azide solution for 4 days
PDB Compounds: (M:) cytochrome c oxidase subunit 8b, mitochondrial

SCOPe Domain Sequences for d5z84m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z84m_ f.23.7.1 (M:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

SCOPe Domain Coordinates for d5z84m_:

Click to download the PDB-style file with coordinates for d5z84m_.
(The format of our PDB-style files is described here.)

Timeline for d5z84m_: