Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) automatically mapped to Pfam PF02285 |
Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins) |
Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
Species Cow (Bos taurus) [TaxId:9913] [81428] (33 PDB entries) |
Domain d1v54m_: 1v54 M: [100334] Other proteins in same PDB: d1v54a_, d1v54b1, d1v54b2, d1v54c_, d1v54d_, d1v54e_, d1v54f_, d1v54g_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54n_, d1v54o1, d1v54o2, d1v54p_, d1v54q_, d1v54r_, d1v54s_, d1v54t_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 1v54 (more details), 1.8 Å
SCOPe Domain Sequences for d1v54m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v54m_ f.23.7.1 (M:) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus) [TaxId: 9913]} itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
Timeline for d1v54m_:
View in 3D Domains from other chains: (mouse over for more information) d1v54a_, d1v54b1, d1v54b2, d1v54c_, d1v54d_, d1v54e_, d1v54f_, d1v54g_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54n_, d1v54o1, d1v54o2, d1v54p_, d1v54q_, d1v54r_, d1v54s_, d1v54t_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_ |