Lineage for d5z84h_ (5z84 H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714739Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2714740Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2714741Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2714802Protein automated matches [190271] (1 species)
    not a true protein
  7. 2714803Species Cow (Bos taurus) [TaxId:9913] [187063] (26 PDB entries)
  8. 2714836Domain d5z84h_: 5z84 H: [356126]
    Other proteins in same PDB: d5z84a_, d5z84b1, d5z84b2, d5z84c_, d5z84d_, d5z84e_, d5z84f_, d5z84g_, d5z84i_, d5z84j_, d5z84k_, d5z84l_, d5z84m_, d5z84n_, d5z84o1, d5z84o2, d5z84p_, d5z84q_, d5z84r_, d5z84s_, d5z84t_, d5z84v_, d5z84w_, d5z84x_, d5z84y_, d5z84z_
    automated match to d1v54h_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5z84h_

PDB Entry: 5z84 (more details), 1.85 Å

PDB Description: the structure of azide-bound cytochrome c oxidase determined using the crystals exposed to 20 mm azide solution for 4 days
PDB Compounds: (H:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d5z84h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z84h_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d5z84h_:

Click to download the PDB-style file with coordinates for d5z84h_.
(The format of our PDB-style files is described here.)

Timeline for d5z84h_: