Lineage for d4pfk__ (4pfk -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.89: Phosphofructokinase [53783] (1 superfamily) Superfamily c.89.1: Phosphofructokinase [53784] (1 family) 
Family c.89.1.1: Phosphofructokinase [53785] (1 protein) Protein Phosphofructokinase [53786] (2 species) 
Species Bacillus stearothermophilus [TaxId:1422] [53788] (3 PDB entries) 
Domain d4pfk__: 4pfk - [35582]
Details for d4pfk__
PDB Entry: 4pfk (more details), 2.4 Å
PDB Description: phosphofructokinase. structure and control
SCOP Domain Sequences for d4pfk__:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pfk__ c.89.1.1 (-) Phosphofructokinase {Bacillus stearothermophilus}
mkrigvltsggdspgmnaairsvvrkaiyhgvevygvyhgyagliagnikklevgdvgdi
ihrggtilytarcpefkteegqkkgieqlkkhgiqglvviggdgsyqgakkltehgfpcv
gvpgtidndipgtdftigfdtalntvidaidkirdtatshertyvievmgrhagdialws
glaggaetilipeadydmndviarlkrghergkkhsiiivaegvgsgvdfgrqiqeatgf
etrvtvlghvqrggsptafdrvlasrlgaravelllegkggrcvgiqnnqlvdhdiaeal
ankhtidqrmyalskelsi
SCOP Domain Coordinates for d4pfk__:
Click to download the PDB-style file with coordinates for d4pfk__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4pfk__:
- d4pfk__ appears in SCOP 1.57
- d4pfk__ appears in the current release, SCOPe 2.08, called d4pfka_
View in 3D