![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.89: Phosphofructokinase [53783] (1 superfamily) consists of two non-similar domains, 3 layers (a/b/a) each Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest Domain 2 has parallel sheet of 4 strands, order 2314 |
![]() | Superfamily c.89.1: Phosphofructokinase [53784] (2 families) ![]() |
![]() | Family c.89.1.1: Phosphofructokinase [53785] (3 proteins) |
![]() | Protein ATP-dependent phosphofructokinase [53786] (2 species) Domain 1 binds ATP |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [53788] (8 PDB entries) |
![]() | Domain d4pfka_: 4pfk A: [35582] complexed with adp, f6p, mg |
PDB Entry: 4pfk (more details), 2.4 Å
SCOPe Domain Sequences for d4pfka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pfka_ c.89.1.1 (A:) ATP-dependent phosphofructokinase {Bacillus stearothermophilus [TaxId: 1422]} mkrigvltsggdspgmnaairsvvrkaiyhgvevygvyhgyagliagnikklevgdvgdi ihrggtilytarcpefkteegqkkgieqlkkhgiqglvviggdgsyqgakkltehgfpcv gvpgtidndipgtdftigfdtalntvidaidkirdtatshertyvievmgrhagdialws glaggaetilipeadydmndviarlkrghergkkhsiiivaegvgsgvdfgrqiqeatgf etrvtvlghvqrggsptafdrvlasrlgaravelllegkggrcvgiqnnqlvdhdiaeal ankhtidqrmyalskelsi
Timeline for d4pfka_: