Lineage for d6fd7a1 (6fd7 A:133-255)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. Protein automated matches [191037] (12 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [255451] (15 PDB entries)
  8. Domain d6fd7a1: 6fd7 A:133-255 [355492]
    Other proteins in same PDB: d6fd7a2
    automated match to d4gcoa_

Details for d6fd7a1

PDB Entry: 6fd7 (more details)

PDB Description: nmr structure of the first tpr domain of the human rpap3 protein
PDB Compounds: (A:) RNA polymerase II-associated protein 3

SCOPe Domain Sequences for d6fd7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fd7a1 a.118.8.0 (A:133-255) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alvlkekgnkyfkqgkydeaidcytkgmdadpynpvlptnrasayfrlkkfavaesdcnl
avalnrsytkaysrrgaarfalqkleeakkdyervlelepnnfeatnelrkisqalaske
nsy

SCOPe Domain Coordinates for d6fd7a1 are not available.

Timeline for d6fd7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fd7a2