SCOPe 2.08: Domain d6fd7a1: 6fd7 A:133-255

Lineage for d6fd7a1 (6fd7 A:133-255)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (11 families)

5. Family a.118.8.0: automated matches [191581] (1 protein)
   not a true family

6. Protein automated matches [191037] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255451] (15 PDB entries)

8. Domain d6fd7a1: 6fd7 A:133-255 [355492]
   Other proteins in same PDB: d6fd7a2
   automated match to d4gcoa_

Details for d6fd7a1

PDB Entry: 6fd7

PDB Description: nmr structure of the first tpr domain of the human rpap3 protein

PDB Compounds: (A:) RNA polymerase II-associated protein 3

SCOPe Domain Sequences for d6fd7a1:

Sequence; same for both SEQRES and ATOM records:

>d6fd7a1 a.118.8.0 (A:133-255) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alvlkekgnkyfkqgkydeaidcytkgmdadpynpvlptnrasayfrlkkfavaesdcnl
avalnrsytkaysrrgaarfalqkleeakkdyervlelepnnfeatnelrkisqalaske
nsy

Timeline for d6fd7a1:

• d6fd7a1 first appeared in SCOPe 2.07