PDB entry 6fd7

View 6fd7 on RCSB PDB site
Description: NMR structure of the first TPR domain of the human RPAP3 protein
Class: chaperone
Keywords: TPR HSP chaperone, chaperone
Deposited on 2017-12-22, released 2018-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II-associated protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RPAP3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H6T3 (4-126)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d6fd7a1, d6fd7a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fd7A (A:)
    gphmalvlkekgnkyfkqgkydeaidcytkgmdadpynpvlptnrasayfrlkkfavaes
    dcnlavalnrsytkaysrrgaarfalqkleeakkdyervlelepnnfeatnelrkisqal
    askensy