Lineage for d6bl1c1 (6bl1 C:3-414)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. Protein NADP-dependent isocitrate dehydrogenase [82524] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [110715] (31 PDB entries)
    Uniprot O75874
  8. Domain d6bl1c1: 6bl1 C:3-414 [355184]
    Other proteins in same PDB: d6bl1a2, d6bl1b2, d6bl1c2
    automated match to d1t0la_
    complexed with ca, dwg, ict

Details for d6bl1c1

PDB Entry: 6bl1 (more details), 2.02 Å

PDB Description: novel modes of inhibition of wild-type idh1: direct covalent modification of his315 with cmpd13
PDB Compounds: (C:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOPe Domain Sequences for d6bl1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bl1c1 c.77.1.1 (C:3-414) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
aikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvs
gwvkpiiigrhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgm
ynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaq
kiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgkt
veaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleev
sietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl

SCOPe Domain Coordinates for d6bl1c1 are not available.

Timeline for d6bl1c1:

Domains from same chain:
(mouse over for more information)
d6bl1c2
Domains from other chains:
(mouse over for more information)
d6bl1a1, d6bl1a2, d6bl1b1, d6bl1b2