Lineage for d6fs8b1 (6fs8 B:1-192)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459948Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2459949Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2460385Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 2460386Protein PA N-terminal domain [254375] (7 species)
  7. 3054466Species Influenza b virus (b/memphis/13/2003) [TaxId:1601067] [354528] (3 PDB entries)
  8. 3054617Domain d6fs8b1: 6fs8 B:1-192 [354679]
    automated match to d4nfza_
    complexed with e4z, mn

Details for d6fs8b1

PDB Entry: 6fs8 (more details), 1.8 Å

PDB Description: influenza b/memphis/13/03 endonuclease with bound inhibitor, baloxavir acid (bxa)
PDB Compounds: (B:) Polymerase acidic protein

SCOPe Domain Sequences for d6fs8b1:

Sequence, based on SEQRES records: (download)

>d6fs8b1 c.52.1.34 (B:1-192) PA N-terminal domain {Influenza b virus (b/memphis/13/2003) [TaxId: 1601067]}
mdtfitrnfqttiiqkakntmaefsedpelqpamlfnicvhlevcyvisdmnfldeegks
ytalegqgkeqnlrpqyeviegmprtiawmvqrslaqehgietpkyladlfdyktkrfie
vgitkgladdyfwkkkeklgnsmelmifsynqdyslsnessldeegkgrvlsrltelqae
lslknlwqvlig

Sequence, based on observed residues (ATOM records): (download)

>d6fs8b1 c.52.1.34 (B:1-192) PA N-terminal domain {Influenza b virus (b/memphis/13/2003) [TaxId: 1601067]}
mdtfitrnfqttiiqkakntmaefsedpelqpamlfnicvhlevcyvisdmnfldeegks
ytnlrpqyeviegmprtiawmvqrslaqehgietpkyladlfdyktkrfievgitkglad
dyfwkkkeklgnsmelmifsynqdyslsnessldeegkgrvlsrltelqaelslknlwqv
lig

SCOPe Domain Coordinates for d6fs8b1:

Click to download the PDB-style file with coordinates for d6fs8b1.
(The format of our PDB-style files is described here.)

Timeline for d6fs8b1:

  • d6fs8b1 is new in SCOPe 2.07-stable