PDB entry 6fs8

View 6fs8 on RCSB PDB site
Description: Influenza B/Memphis/13/03 endonuclease with bound inhibitor, baloxavir acid (BXA)
Class: viral protein
Keywords: Influenza, endonuclease, inhibitor, VIRAL PROTEIN
Deposited on 2018-02-19, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase acidic protein
    Species: INFLUENZA B VIRUS (B/MEMPHIS/13/2003) [TaxId:1601067]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5V8Z9 (8-End)
      • expression tag (6-7)
    Domains in SCOPe 2.07: d6fs8a1, d6fs8a2
  • Chain 'B':
    Compound: Polymerase acidic protein
    Species: INFLUENZA B VIRUS (B/MEMPHIS/13/2003) [TaxId:1601067]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5V8Z9 (8-End)
      • expression tag (6-7)
      • conflict (67)
    Domains in SCOPe 2.07: d6fs8b1, d6fs8b2
  • Heterogens: E4Z, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fs8A (A:)
    gamgsgmamdtfitrnfqttiiqkakntmaefsedpelqpamlfnicvhlevcyvisdmn
    fldeegksytalegqgkeqnlrpqyeviegmprtiawmvqrslaqehgietpkyladlfd
    yktkrfievgitkgladdyfwkkkeklgnsmelmifsynqdyslsnessldeegkgrvls
    rltelqaelslknlwqvligeedve
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fs8A (A:)
    mamdtfitrnfqttiiqkakntmaefsedpelqpamlfnicvhlevcyvisdmnfllrpq
    yeviegmprtiawmvqrslaqehgietpkyladlfdyktkrfievgitkgladdyfwkkk
    eklgnsmelmifsynqdyslsnessldeegkgrvlsrltelqaelslknlwqvlig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fs8B (B:)
    gamgsgmamdtfitrnfqttiiqkakntmaefsedpelqpamlfnicvhlevcyvisdmn
    fldeegksytalegqgkeqnlrpqyeviegmprtiawmvqrslaqehgietpkyladlfd
    yktkrfievgitkgladdyfwkkkeklgnsmelmifsynqdyslsnessldeegkgrvls
    rltelqaelslknlwqvligeedve
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fs8B (B:)
    mamdtfitrnfqttiiqkakntmaefsedpelqpamlfnicvhlevcyvisdmnfldeeg
    ksytnlrpqyeviegmprtiawmvqrslaqehgietpkyladlfdyktkrfievgitkgl
    addyfwkkkeklgnsmelmifsynqdyslsnessldeegkgrvlsrltelqaelslknlw
    qvlig