Lineage for d13pka_ (13pk A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27761Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
  4. 27762Superfamily c.86.1: Phosphoglycerate kinase [53748] (1 family) (S)
  5. 27763Family c.86.1.1: Phosphoglycerate kinase [53749] (1 protein)
  6. 27764Protein Phosphoglycerate kinase [53750] (4 species)
  7. 27772Species Trypanosoma brucei [TaxId:5691] [53754] (2 PDB entries)
  8. 27774Domain d13pka_: 13pk A: [35455]

Details for d13pka_

PDB Entry: 13pk (more details), 2.5 Å

PDB Description: ternary complex of phosphoglycerate kinase from trypanosoma brucei

SCOP Domain Sequences for d13pka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d13pka_ c.86.1.1 (A:) Phosphoglycerate kinase {Trypanosoma brucei}
ekksinecdlkgkkvlirvdfnvpvkngkitndyrirsalptlkkvlteggscvlmshlg
rpkgipmaqagkirstggvpgfqqkatlkpvakrlselllrpvtfapdclnaadvvskms
pgdvvllenvrfykeegskkakdreamakilasygdvyisdafgtahrdsatmtgipkil
gngaagylmekeisyfakvlgnpprplvaivggakvsdkiqlldnmlqridylliggama
ytflkaqgysigkskceesklefarsllkkaedrkvqvilpidhvchtefkavdsplite
dqnipeghmaldigpktiekyvqtigkcksaiwngpmgvfemvpyskgtfaiakamgrgt
hehglmsiigggdsasaaelsgeakrmshvstgggaslellegktlpgvtvlddk

SCOP Domain Coordinates for d13pka_:

Click to download the PDB-style file with coordinates for d13pka_.
(The format of our PDB-style files is described here.)

Timeline for d13pka_: