Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226777] (6 PDB entries) |
Domain d6cerf1: 6cer F:1-185 [354483] Other proteins in same PDB: d6cerb2, d6cerb3, d6cerd2, d6cerd3, d6cerf2, d6cerf3, d6cerh2, d6cerh3 automated match to d3exeb1 complexed with mg, tdp; mutant |
PDB Entry: 6cer (more details), 2.69 Å
SCOPe Domain Sequences for d6cerf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cerf1 c.36.1.0 (F:1-185) automated matches {Human (Homo sapiens) [TaxId: 9606]} lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf efppe
Timeline for d6cerf1: