Lineage for d6cerh2 (6cer H:186-329)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2458950Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2458951Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2459003Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins)
    automatically mapped to Pfam PF02780
  6. 2459041Protein E1-beta subunit of pyruvate dehydrogenase, C-domain [69521] (2 species)
  7. 2459042Species Human (Homo sapiens) [TaxId:9606] [89713] (9 PDB entries)
  8. 3054425Domain d6cerh2: 6cer H:186-329 [354487]
    Other proteins in same PDB: d6cerb1, d6cerb3, d6cerd1, d6cerd3, d6cerf1, d6cerf3, d6cerh1, d6cerh3
    automated match to d3exeb2
    complexed with mg, tdp; mutant

Details for d6cerh2

PDB Entry: 6cer (more details), 2.69 Å

PDB Description: human pyruvate dehydrogenase complex e1 component v138m mutation
PDB Compounds: (H:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d6cerh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cerh2 c.48.1.2 (H:186-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
aqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrtirpmd
metieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadvpmpya
kilednsipqvkdiifaikktlni

SCOPe Domain Coordinates for d6cerh2:

Click to download the PDB-style file with coordinates for d6cerh2.
(The format of our PDB-style files is described here.)

Timeline for d6cerh2: