SCOPe 2.08: Domain d6cerb1: 6cer B:1-185

Lineage for d6cerb1 (6cer B:1-185)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226777] (6 PDB entries)

8. Domain d6cerb1: 6cer B:1-185 [354508]
   Other proteins in same PDB: d6cerb2, d6cerb3, d6cerd2, d6cerd3, d6cerf2, d6cerf3, d6cerh2, d6cerh3
   automated match to d3exeb1
   complexed with mg, tdp; mutant

Details for d6cerb1

PDB Entry: 6cer, 2.69 Å

PDB Description: human pyruvate dehydrogenase complex e1 component v138m mutation

PDB Compounds: (B:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d6cerb1:

Sequence; same for both SEQRES and ATOM records:

>d6cerb1 c.36.1.0 (B:1-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
efppe

Timeline for d6cerb1:

• d6cerb1 first appeared in SCOPe 2.07