Lineage for d6cerh1 (6cer H:1-185)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445862Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2445863Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2446486Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2446487Protein automated matches [227126] (21 species)
    not a true protein
  7. 2446579Species Human (Homo sapiens) [TaxId:9606] [226777] (6 PDB entries)
  8. 3054424Domain d6cerh1: 6cer H:1-185 [354486]
    Other proteins in same PDB: d6cerb2, d6cerb3, d6cerd2, d6cerd3, d6cerf2, d6cerf3, d6cerh2, d6cerh3
    automated match to d3exeb1
    complexed with mg, tdp; mutant

Details for d6cerh1

PDB Entry: 6cer (more details), 2.69 Å

PDB Description: human pyruvate dehydrogenase complex e1 component v138m mutation
PDB Compounds: (H:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d6cerh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cerh1 c.36.1.0 (H:1-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
efppe

SCOPe Domain Coordinates for d6cerh1:

Click to download the PDB-style file with coordinates for d6cerh1.
(The format of our PDB-style files is described here.)

Timeline for d6cerh1: