Lineage for d5oyad2 (5oya D:154-483)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838730Protein automated matches [226984] (16 species)
    not a true protein
  7. 2838731Species Chaetoceros socialis [TaxId:163503] [353964] (1 PDB entry)
  8. 2838735Domain d5oyad2: 5oya D:154-483 [354169]
    Other proteins in same PDB: d5oyaa1, d5oyab1, d5oyac1, d5oyad1, d5oyae1, d5oyaf1, d5oyag1, d5oyah1, d5oyai_, d5oyaj_, d5oyak_, d5oyal_, d5oyam_, d5oyan_, d5oyao_, d5oyap_
    automated match to d1bwva1
    complexed with cap, edo, mg

Details for d5oyad2

PDB Entry: 5oya (more details), 1.8 Å

PDB Description: unusual posttranslational modifications revealed in crystal structures of diatom rubisco.
PDB Compounds: (D:) Rubisco large subunit

SCOPe Domain Sequences for d5oyad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oyad2 c.1.14.1 (D:154-483) automated matches {Chaetoceros socialis [TaxId: 163503]}
gpatgiivererlnkygtplxgatvkpklglsgknygrvvyeglkggldflkddeninsq
pfmrwrerflncleginrasaatgevkgsylnvtaatmeevykraeyakaigsivvmidl
vmgytaiqsiaywarendmllhlhragnstyarqknhginfrvickwmrmsgvdhihagt
vvgklegdplmikgfydilrltelevnlpfgiffemdwaslrrcmpvasggihcgqmhql
ihylgddvvlqfgggtighpdgiqagatanrvaleamvlarnegadyfnnqvgpqilrda
aktcgplqtaldlwkdisfnytstdtadfs

SCOPe Domain Coordinates for d5oyad2:

Click to download the PDB-style file with coordinates for d5oyad2.
(The format of our PDB-style files is described here.)

Timeline for d5oyad2: