SCOPe 2.08: Domain d5oyaa1: 5oya A:16-153

Lineage for d5oyaa1 (5oya A:16-153)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Chaetoceros socialis [TaxId:163503] [353962] (1 PDB entry)

8. Domain d5oyaa1: 5oya A:16-153 [354046]
   Other proteins in same PDB: d5oyaa2, d5oyab2, d5oyac2, d5oyad2, d5oyae2, d5oyaf2, d5oyag2, d5oyah2, d5oyai_, d5oyaj_, d5oyak_, d5oyal_, d5oyam_, d5oyan_, d5oyao_, d5oyap_
   automated match to d1bwva2
   complexed with cap, edo, mg

Details for d5oyaa1

PDB Entry: 5oya, 1.8 Å

PDB Description: unusual posttranslational modifications revealed in crystal structures of diatom rubisco.

PDB Compounds: (A:) Rubisco large subunit

SCOPe Domain Sequences for d5oyaa1:

Sequence; same for both SEQRES and ATOM records:

>d5oyaa1 d.58.9.0 (A:16-153) automated matches {Chaetoceros socialis [TaxId: 163503]}
yesgvipyakmgywdaaytvkdtdvlalfritpqpgvdpveaaaavagesstatwtvvwt
dlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslanltasiignvfgfkais
alrledmriphsylxtfq

Timeline for d5oyaa1:

• d5oyaa1 first appeared in SCOPe 2.07