Lineage for d5oyab2 (5oya B:154-483)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2424105Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2424106Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2424311Protein automated matches [226984] (14 species)
    not a true protein
  7. 3053902Species Chaetoceros socialis [TaxId:163503] [353964] (1 PDB entry)
  8. 3053966Domain d5oyab2: 5oya B:154-483 [354028]
    Other proteins in same PDB: d5oyaa1, d5oyab1, d5oyac1, d5oyad1, d5oyae1, d5oyaf1, d5oyag1, d5oyah1, d5oyai_, d5oyaj_, d5oyak_, d5oyal_, d5oyam_, d5oyan_, d5oyao_, d5oyap_
    automated match to d1bwva1
    complexed with cap, edo, mg

Details for d5oyab2

PDB Entry: 5oya (more details), 1.8 Å

PDB Description: unusual posttranslational modifications revealed in crystal structures of diatom rubisco.
PDB Compounds: (B:) Rubisco large subunit

SCOPe Domain Sequences for d5oyab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oyab2 c.1.14.1 (B:154-483) automated matches {Chaetoceros socialis [TaxId: 163503]}
gpatgiivererlnkygtplxgatvkpklglsgknygrvvyeglkggldflkddeninsq
pfmrwrerflncleginrasaatgevkgsylnvtaatmeevykraeyakaigsivvmidl
vmgytaiqsiaywarendmllhlhragnstyarqknhginfrvickwmrmsgvdhihagt
vvgklegdplmikgfydilrltelevnlpfgiffemdwaslrrcmpvasggihcgqmhql
ihylgddvvlqfgggtighpdgiqagatanrvaleamvlarnegadyfnnqvgpqilrda
aktcgplqtaldlwkdisfnytstdtadfs

SCOPe Domain Coordinates for d5oyab2:

Click to download the PDB-style file with coordinates for d5oyab2.
(The format of our PDB-style files is described here.)

Timeline for d5oyab2:

  • d5oyab2 appears in periodic updates to SCOPe 2.07 starting on 2018-06-28