| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
| Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
| Protein automated matches [226983] (27 species) not a true protein |
| Species Chaetoceros socialis [TaxId:163503] [353962] (1 PDB entry) |
| Domain d5oyah1: 5oya H:16-153 [353963] Other proteins in same PDB: d5oyaa2, d5oyab2, d5oyac2, d5oyad2, d5oyae2, d5oyaf2, d5oyag2, d5oyah2, d5oyai_, d5oyaj_, d5oyak_, d5oyal_, d5oyam_, d5oyan_, d5oyao_, d5oyap_ automated match to d1bwva2 complexed with cap, edo, mg |
PDB Entry: 5oya (more details), 1.8 Å
SCOPe Domain Sequences for d5oyah1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oyah1 d.58.9.0 (H:16-153) automated matches {Chaetoceros socialis [TaxId: 163503]}
yesgvipyakmgywdaaytvkdtdvlalfritpqpgvdpveaaaavagesstatwtvvwt
dlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslanltasiignvfgfkais
alrledmriphsylxtfq
Timeline for d5oyah1: