SCOPe 2.08: Domain d6d6sb2: 6d6s B:132-247

Lineage for d6d6sb2 (6d6s B:132-247)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [267790] (2 PDB entries)

8. Domain d6d6sb2: 6d6s B:132-247 [353447]
   Other proteins in same PDB: d6d6sa1, d6d6sa3, d6d6sb1, d6d6sb3
   automated match to d1w26a3

Details for d6d6sb2

PDB Entry: 6d6s

PDB Description: solution structure of trigger factor dimer

PDB Compounds: (B:) Trigger Factor

SCOPe Domain Sequences for d6d6sb2:

Sequence; same for both SEQRES and ATOM records:

>d6d6sb2 d.26.1.0 (B:132-247) automated matches {Escherichia coli [TaxId: 83333]}
vtdadvdgmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefeggkasdfvlamgq
grmipgfedgikghkageeftidvtfpeeyhaenlkgkaakfainlkkveerelpe

Timeline for d6d6sb2:

• d6d6sb2 first appeared in SCOPe 2.07