PDB entry 6d6s

View 6d6s on RCSB PDB site
Description: Solution structure of Trigger Factor dimer
Class: chaperone
Keywords: protein folding, molecular chaperone, oligomerization, CHAPERONE
Deposited on 2018-04-22, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trigger Factor
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: tig, b0436, JW0426
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d6sa1, d6d6sa2, d6d6sa3
  • Chain 'B':
    Compound: Trigger Factor
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: tig, b0436, JW0426
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d6sb1, d6d6sb2, d6d6sb3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d6sA (A:)
    mnhkvhhhhhhmqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkv
    pmnivaqrygasvrqdvlgdlmsrnfidaiikekinpagaptyvpgeyklgedftysvef
    evypevelqgleaievekpivevtdadvdgmldtlrkqqatwkekdgaveaedrvtidft
    gsvdgeefeggkasdfvlamgqgrmipgfedgikghkageeftidvtfpeeyhaenlkgk
    aakfainlkkveerelpeltaefikrfgvedgsveglraevrknmerelksairnrvksq
    aieglvkandidvpaalidseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvgl
    llgevirtnelkadeervkglieemasayedpkeviefysknkelmdnmrnvaleeqave
    avlakakvtekettfnelmnqqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d6sA (A:)
    mqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkvpmnivaqryga
    svrqdvlgdlmsrnfidaiikekinpagaptyvpgeyklgedftysvefevypevelqgl
    eaievekpivevtdadvdgmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefegg
    kasdfvlamgqgrmipgfedgikghkageeftidvtfpeeyhaenlkgkaakfainlkkv
    eerelpeltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandi
    dvpaalidseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnel
    kadeervkglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtek
    ettfnelmnqqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d6sB (B:)
    mnhkvhhhhhhmqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkv
    pmnivaqrygasvrqdvlgdlmsrnfidaiikekinpagaptyvpgeyklgedftysvef
    evypevelqgleaievekpivevtdadvdgmldtlrkqqatwkekdgaveaedrvtidft
    gsvdgeefeggkasdfvlamgqgrmipgfedgikghkageeftidvtfpeeyhaenlkgk
    aakfainlkkveerelpeltaefikrfgvedgsveglraevrknmerelksairnrvksq
    aieglvkandidvpaalidseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvgl
    llgevirtnelkadeervkglieemasayedpkeviefysknkelmdnmrnvaleeqave
    avlakakvtekettfnelmnqqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d6sB (B:)
    mqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkvpmnivaqryga
    svrqdvlgdlmsrnfidaiikekinpagaptyvpgeyklgedftysvefevypevelqgl
    eaievekpivevtdadvdgmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefegg
    kasdfvlamgqgrmipgfedgikghkageeftidvtfpeeyhaenlkgkaakfainlkkv
    eerelpeltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandi
    dvpaalidseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnel
    kadeervkglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtek
    ettfnelmnqqa