Lineage for d6d6sa3 (6d6s A:248-432)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343047Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 2343048Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (3 families) (S)
    there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family)
  5. 2343067Family a.223.1.0: automated matches [256442] (1 protein)
    not a true family
  6. 2343068Protein automated matches [256443] (3 species)
    not a true protein
  7. 3053387Species Escherichia coli [TaxId:83333] [353449] (1 PDB entry)
  8. 3053403Domain d6d6sa3: 6d6s A:248-432 [353465]
    Other proteins in same PDB: d6d6sa1, d6d6sa2, d6d6sb1, d6d6sb2
    automated match to d1w26a1

Details for d6d6sa3

PDB Entry: 6d6s (more details)

PDB Description: solution structure of trigger factor dimer
PDB Compounds: (A:) Trigger Factor

SCOPe Domain Sequences for d6d6sa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d6sa3 a.223.1.0 (A:248-432) automated matches {Escherichia coli [TaxId: 83333]}
ltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandidvpaali
dseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnelkadeerv
kglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtekettfnel
mnqqa

SCOPe Domain Coordinates for d6d6sa3:

Click to download the PDB-style file with coordinates for d6d6sa3.
(The format of our PDB-style files is described here.)

Timeline for d6d6sa3:

  • d6d6sa3 is new in SCOPe 2.07-stable