SCOPe 2.08: Domain d6fjfd1: 6fjf D:1-245

Lineage for d6fjfd1 (6fjf D:1-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries)

8. Domain d6fjfd1: 6fjf D:1-245 [352771]
   Other proteins in same PDB: d6fjfb2, d6fjfc2, d6fjfd2, d6fjfe_, d6fjff1, d6fjff2, d6fjff3
   automated match to d4drxb1
   complexed with acp, ca, dke, dms, gdp, gtp, mes, mg, peg

Details for d6fjfd1

PDB Entry: 6fjf, 2.4 Å

PDB Description: tubulin-fcmaytansine complex

PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6fjfd1:

Sequence; same for both SEQRES and ATOM records:

>d6fjfd1 c.32.1.1 (D:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d6fjfd1:

• d6fjfd1 first appeared in SCOPe 2.07