![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein automated matches [226837] (9 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries) |
![]() | Domain d6fjfd1: 6fjf D:1-245 [352771] Other proteins in same PDB: d6fjfb2, d6fjfc2, d6fjfd2, d6fjfe_, d6fjff1, d6fjff2, d6fjff3 automated match to d4drxb1 complexed with acp, ca, dke, dms, gdp, gtp, mes, mg, peg |
PDB Entry: 6fjf (more details), 2.4 Å
SCOPe Domain Sequences for d6fjfd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fjfd1 c.32.1.1 (D:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]} mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl rfp
Timeline for d6fjfd1: