![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
![]() | Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [311385] (175 PDB entries) |
![]() | Domain d6fjff2: 6fjf F:77-378 [352835] Other proteins in same PDB: d6fjfb1, d6fjfb2, d6fjfc1, d6fjfc2, d6fjfd1, d6fjfd2, d6fjfe_, d6fjff1, d6fjff3 automated match to d3tiia2 complexed with acp, ca, dke, dms, gdp, gtp, mes, mg, peg |
PDB Entry: 6fjf (more details), 2.4 Å
SCOPe Domain Sequences for d6fjff2:
Sequence, based on SEQRES records: (download)
>d6fjff2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d6fjff2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptderevflaaynrrregregnvwiakssgegili sseaselldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlr tssepynsanfqdktchltnhciqkeysknygryeegnemffeefnqylmdalnttlens illqikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqkl yaelcqgivdvaissvfplaptsifikl
Timeline for d6fjff2: