Lineage for d6fjfe_ (6fjf E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339505Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2339704Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2339705Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2339706Protein Stathmin 4 [101496] (2 species)
  7. 2339707Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (99 PDB entries)
  8. 3052881Domain d6fjfe_: 6fjf E: [352943]
    Other proteins in same PDB: d6fjfb1, d6fjfb2, d6fjfc1, d6fjfc2, d6fjfd1, d6fjfd2, d6fjff1, d6fjff2, d6fjff3
    automated match to d4i55e_
    complexed with acp, ca, dke, dms, gdp, gtp, mes, mg, peg

Details for d6fjfe_

PDB Entry: 6fjf (more details), 2.4 Å

PDB Description: tubulin-fcmaytansine complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d6fjfe_:

Sequence, based on SEQRES records: (download)

>d6fjfe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records): (download)

>d6fjfe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

SCOPe Domain Coordinates for d6fjfe_:

Click to download the PDB-style file with coordinates for d6fjfe_.
(The format of our PDB-style files is described here.)

Timeline for d6fjfe_:

  • d6fjfe_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-31