Lineage for d6fjfc2 (6fjf C:246-440)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959219Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)
  8. 2959625Domain d6fjfc2: 6fjf C:246-440 [352801]
    Other proteins in same PDB: d6fjfb1, d6fjfc1, d6fjfd1, d6fjfe_, d6fjff1, d6fjff2, d6fjff3
    automated match to d4i50a2
    complexed with acp, ca, dke, dms, gdp, gtp, mes, mg, peg

Details for d6fjfc2

PDB Entry: 6fjf (more details), 2.4 Å

PDB Description: tubulin-fcmaytansine complex
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6fjfc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fjfc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d6fjfc2:

Click to download the PDB-style file with coordinates for d6fjfc2.
(The format of our PDB-style files is described here.)

Timeline for d6fjfc2: