Lineage for d6fjfb1 (6fjf B:2-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863308Protein automated matches [226837] (9 species)
    not a true protein
  7. 2863314Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries)
  8. 2863719Domain d6fjfb1: 6fjf B:2-245 [352841]
    Other proteins in same PDB: d6fjfb2, d6fjfc2, d6fjfd2, d6fjfe_, d6fjff1, d6fjff2, d6fjff3
    automated match to d4drxb1
    complexed with acp, ca, dke, dms, gdp, gtp, mes, mg, peg

Details for d6fjfb1

PDB Entry: 6fjf (more details), 2.4 Å

PDB Description: tubulin-fcmaytansine complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6fjfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fjfb1 c.32.1.1 (B:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

SCOPe Domain Coordinates for d6fjfb1:

Click to download the PDB-style file with coordinates for d6fjfb1.
(The format of our PDB-style files is described here.)

Timeline for d6fjfb1: