SCOPe 2.08: Domain d6d72b1: 6d72 B:1-175

Lineage for d6d72b1 (6d72 B:1-175)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [337326] (2 PDB entries)

8. Domain d6d72b1: 6d72 B:1-175 [352058]
   Other proteins in same PDB: d6d72b2, d6d72c2
   automated match to d4r9ma_
   complexed with ca, mli, peg

Details for d6d72b1

PDB Entry: 6d72, 2.17 Å

PDB Description: crystal structure of spermidine/spermine n-acetyltransferase speg from yersinia pestis in complex with calcium ions.

PDB Compounds: (B:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d6d72b1:

Sequence; same for both SEQRES and ATOM records:

>d6d72b1 d.108.1.0 (B:1-175) automated matches {Yersinia pestis [TaxId: 632]}
msttssvrlrpleredlpfvhqldnnasimrywfeepyeafvelcdlydkhihdqserrf
iiesqgtkiglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnlykl
ylivdkenekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakykt

Timeline for d6d72b1:

• d6d72b1 first appeared in SCOPe 2.07