Lineage for d6d72b1 (6d72 B:1-175)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969648Species Yersinia pestis [TaxId:632] [337326] (2 PDB entries)
  8. 2969650Domain d6d72b1: 6d72 B:1-175 [352058]
    Other proteins in same PDB: d6d72b2, d6d72c2
    automated match to d4r9ma_
    complexed with ca, mli, peg

Details for d6d72b1

PDB Entry: 6d72 (more details), 2.17 Å

PDB Description: crystal structure of spermidine/spermine n-acetyltransferase speg from yersinia pestis in complex with calcium ions.
PDB Compounds: (B:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d6d72b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d72b1 d.108.1.0 (B:1-175) automated matches {Yersinia pestis [TaxId: 632]}
msttssvrlrpleredlpfvhqldnnasimrywfeepyeafvelcdlydkhihdqserrf
iiesqgtkiglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnlykl
ylivdkenekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakykt

SCOPe Domain Coordinates for d6d72b1:

Click to download the PDB-style file with coordinates for d6d72b1.
(The format of our PDB-style files is described here.)

Timeline for d6d72b1: