PDB entry 6d72

View 6d72 on RCSB PDB site
Description: Crystal structure of spermidine/spermine N-acetyltransferase SpeG from Yersinia pestis in complex with calcium ions.
Class: transferase
Keywords: SpeG, polyamine, GNAT, N-acetyltransferase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2018-04-23, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spermidine n1-acetyltransferase
    Species: Yersinia pestis [TaxId:632]
    Gene: speG, y1405, YP_2698
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d72a_
  • Chain 'B':
    Compound: Spermidine n1-acetyltransferase
    Species: Yersinia pestis [TaxId:632]
    Gene: speG, y1405, YP_2698
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0WD68 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d6d72b1, d6d72b2
  • Chain 'C':
    Compound: Spermidine n1-acetyltransferase
    Species: Yersinia pestis [TaxId:632]
    Gene: speG, y1405, YP_2698
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0WD68 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6d72c1, d6d72c2
  • Heterogens: CA, PEG, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d72A (A:)
    snamsttssvrlrpleredlpfvhqldnnasimrywfeepyeafvelcdlydkhihdqse
    rrfiiesqgtkiglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnl
    yklylivdkenekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakyktps
    ikna
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d72A (A:)
    svrlrpleredlpfvhqldnnasimrywfeepyeafvelcdlydkhihdqserrfiiesq
    gtkiglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnlyklylivd
    kenekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakykt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d72B (B:)
    snamsttssvrlrpleredlpfvhqldnnasimrywfeepyeafvelcdlydkhihdqse
    rrfiiesqgtkiglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnl
    yklylivdkenekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakyktps
    ikna
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d72B (B:)
    amsttssvrlrpleredlpfvhqldnnasimrywfeepyeafvelcdlydkhihdqserr
    fiiesqgtkiglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnlyk
    lylivdkenekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakykt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6d72C (C:)
    snamsttssvrlrpleredlpfvhqldnnasimrywfeepyeafvelcdlydkhihdqse
    rrfiiesqgtkiglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnl
    yklylivdkenekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakyktps
    ikna
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d72C (C:)
    snamsttssvrlrpleredlpfvhqldnnasimrywfeepyeafvelcdlydkhihdqse
    rrfiiesqgtkiglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnl
    yklylivdkenekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakyk