Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (48 species) not a true protein |
Species Yersinia pestis [TaxId:632] [337326] (2 PDB entries) |
Domain d6d72b1: 6d72 B:1-175 [352058] Other proteins in same PDB: d6d72b2, d6d72c2 automated match to d4r9ma_ complexed with ca, mli, peg |
PDB Entry: 6d72 (more details), 2.17 Å
SCOPe Domain Sequences for d6d72b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d72b1 d.108.1.0 (B:1-175) automated matches {Yersinia pestis [TaxId: 632]} msttssvrlrpleredlpfvhqldnnasimrywfeepyeafvelcdlydkhihdqserrf iiesqgtkiglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnlykl ylivdkenekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakykt
Timeline for d6d72b1: