Lineage for d6c2ya3 (6c2y A:551-668)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803789Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)
  8. 2803918Domain d6c2ya3: 6c2y A:551-668 [351422]
    Other proteins in same PDB: d6c2ya1, d6c2ya2, d6c2yb_, d6c2yg_
    automated match to d3krwa3
    complexed with ejs

Details for d6c2ya3

PDB Entry: 6c2y (more details), 2.74 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg257142
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d6c2ya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c2ya3 b.55.1.0 (A:551-668) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsve
etqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

SCOPe Domain Coordinates for d6c2ya3:

Click to download the PDB-style file with coordinates for d6c2ya3.
(The format of our PDB-style files is described here.)

Timeline for d6c2ya3: