Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries) |
Domain d6c2ya3: 6c2y A:551-668 [351422] Other proteins in same PDB: d6c2ya1, d6c2ya2, d6c2yb_, d6c2yg_ automated match to d3krwa3 complexed with ejs |
PDB Entry: 6c2y (more details), 2.74 Å
SCOPe Domain Sequences for d6c2ya3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c2ya3 b.55.1.0 (A:551-668) automated matches {Human (Homo sapiens) [TaxId: 9606]} edyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsve etqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp
Timeline for d6c2ya3: