Lineage for d6c2ya1 (6c2y A:30-185)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. Protein automated matches [190464] (3 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)
  8. Domain d6c2ya1: 6c2y A:30-185 [351407]
    Other proteins in same PDB: d6c2ya2, d6c2ya3, d6c2yb_, d6c2yg_
    automated match to d3v5wa1
    complexed with ejs

Details for d6c2ya1

PDB Entry: 6c2y (more details), 2.74 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg257142
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d6c2ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c2ya1 a.91.1.0 (A:30-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeei
kkyekleteeervarsreifdsyimkellacshpfsksatehvqghlgkkqvppdlfqpy
ieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

SCOPe Domain Coordinates for d6c2ya1 are not available.

Timeline for d6c2ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6c2ya2, d6c2ya3
View in 3D
Domains from other chains:
(mouse over for more information)
d6c2yb_, d6c2yg_