Lineage for d6c2ya2 (6c2y A:186-548)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein automated matches [190091] (20 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188447] (844 PDB entries)
  8. Domain d6c2ya2: 6c2y A:186-548 [351421]
    Other proteins in same PDB: d6c2ya1, d6c2ya3, d6c2yb_, d6c2yg_
    automated match to d3v5wa2
    complexed with ejs

Details for d6c2ya2

PDB Entry: 6c2y (more details), 2.74 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg257142
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d6c2ya2:

Sequence, based on SEQRES records: (download)

>d6c2ya2 d.144.1.7 (A:186-548) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadafdi
gsfdeedtkgiklldsdqelyrnfpltiserwqqevaetvfdtinaetdrlearkkaknk
qlg

Sequence, based on observed residues (ATOM records): (download)

>d6c2ya2 d.144.1.7 (A:186-548) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtlavelpdsfspelrslleg
llqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprtkgiklldsdqel
yrnfpltiserwqqevaetvfdtinaetdrlearkkaknkqlg

SCOPe Domain Coordinates for d6c2ya2 are not available.

Timeline for d6c2ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6c2ya1, d6c2ya3
View in 3D
Domains from other chains:
(mouse over for more information)
d6c2yb_, d6c2yg_