Lineage for d5olna2 (5oln A:71-330)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2469961Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2469962Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) (S)
    automatically mapped to Pfam PF00591
  5. 2470042Family c.27.1.0: automated matches [254295] (1 protein)
    not a true family
  6. 2470043Protein automated matches [254679] (2 species)
    not a true protein
  7. 2470044Species Bacillus subtilis [TaxId:224308] [326393] (2 PDB entries)
  8. 2470045Domain d5olna2: 5oln A:71-330 [351260]
    Other proteins in same PDB: d5olna1, d5olna3, d5olnb1, d5olnb3, d5olnb4
    automated match to d5ep8a2
    complexed with edo, imd, so4

Details for d5olna2

PDB Entry: 5oln (more details), 1.88 Å

PDB Description: x-ray structure of the complex pyrimidine-nucleoside phosphorylase from bacillus subtilis at 1.88 a
PDB Compounds: (A:) Pyrimidine-nucleoside phosphorylase

SCOPe Domain Sequences for d5olna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5olna2 c.27.1.0 (A:71-330) automated matches {Bacillus subtilis [TaxId: 224308]}
lsaiegikvdkhstggvgdtttlvlaplvaaldvpvakmsgrglghtggtidkleaimgf
hveltkdefiklvnrdkvavigqsgnltpadkklyalrdvtgtvnsipliassimskkia
agadaivldvktgagafmkteedaaelakamvrignnvgrqtmavisdmsqplgfaigna
levkeaidtlkgegpedlhelvltlgsqmvvlakkadtldearakleevmkngkalekfk
dflknqggdssivddpsklp

SCOPe Domain Coordinates for d5olna2:

Click to download the PDB-style file with coordinates for d5olna2.
(The format of our PDB-style files is described here.)

Timeline for d5olna2: