![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
![]() | Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) ![]() automatically mapped to Pfam PF02885 |
![]() | Family a.46.2.0: automated matches [254276] (1 protein) not a true family |
![]() | Protein automated matches [254641] (5 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [326391] (2 PDB entries) |
![]() | Domain d5olnb1: 5oln B:1-70 [351258] Other proteins in same PDB: d5olna2, d5olna3, d5olnb2, d5olnb3, d5olnb4 automated match to d5ep8a1 complexed with edo, imd, so4 |
PDB Entry: 5oln (more details), 1.88 Å
SCOPe Domain Sequences for d5olnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5olnb1 a.46.2.0 (B:1-70) automated matches {Bacillus subtilis [TaxId: 224308]} mrmvdiiikkqngkeltteeiqffvngytdgsipdyqasalamaiffqdmsdreradltm amvnsgetid
Timeline for d5olnb1: