| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) ![]() automatically mapped to Pfam PF00591 |
| Family c.27.1.0: automated matches [254295] (1 protein) not a true family |
| Protein automated matches [254679] (2 species) not a true protein |
| Species Bacillus subtilis [TaxId:224308] [326393] (2 PDB entries) |
| Domain d5olna2: 5oln A:71-330 [351260] Other proteins in same PDB: d5olna1, d5olna3, d5olnb1, d5olnb3, d5olnb4 automated match to d5ep8a2 complexed with edo, imd, so4 |
PDB Entry: 5oln (more details), 1.88 Å
SCOPe Domain Sequences for d5olna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5olna2 c.27.1.0 (A:71-330) automated matches {Bacillus subtilis [TaxId: 224308]}
lsaiegikvdkhstggvgdtttlvlaplvaaldvpvakmsgrglghtggtidkleaimgf
hveltkdefiklvnrdkvavigqsgnltpadkklyalrdvtgtvnsipliassimskkia
agadaivldvktgagafmkteedaaelakamvrignnvgrqtmavisdmsqplgfaigna
levkeaidtlkgegpedlhelvltlgsqmvvlakkadtldearakleevmkngkalekfk
dflknqggdssivddpsklp
Timeline for d5olna2:
View in 3DDomains from other chains: (mouse over for more information) d5olnb1, d5olnb2, d5olnb3, d5olnb4 |