Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) automatically mapped to Pfam PF00591 |
Family c.27.1.0: automated matches [254295] (1 protein) not a true family |
Protein automated matches [254679] (2 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [326393] (2 PDB entries) |
Domain d5ep8a2: 5ep8 A:71-330 [326394] Other proteins in same PDB: d5ep8a1, d5ep8a3, d5ep8b1, d5ep8b3 automated match to d3h5qa2 complexed with na, so4 |
PDB Entry: 5ep8 (more details), 2.66 Å
SCOPe Domain Sequences for d5ep8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ep8a2 c.27.1.0 (A:71-330) automated matches {Bacillus subtilis [TaxId: 224308]} lsaiegikvdkhstggvgdtttlvlaplvaaldvpvakmsgrglghtggtidkleaidgf hveltkrefiklvnrdkvavigqsgnltpadkklyalrdvtgtvnsipliassimskkia agadaivldvktgagafmkteedaaelakamvrignnvgrqtmavisdmsqplgfaigna levkeaidtlkgegpedlhelvltlgsqmvvlakkadtldearakleevmkngkalekfk dflknqggdssivddpsklp
Timeline for d5ep8a2: