Lineage for d5ep8b2 (5ep8 B:71-330)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861697Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2861698Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) (S)
    automatically mapped to Pfam PF00591
  5. 2861778Family c.27.1.0: automated matches [254295] (1 protein)
    not a true family
  6. 2861779Protein automated matches [254679] (2 species)
    not a true protein
  7. 2861780Species Bacillus subtilis [TaxId:224308] [326393] (2 PDB entries)
  8. 2861784Domain d5ep8b2: 5ep8 B:71-330 [326398]
    Other proteins in same PDB: d5ep8a1, d5ep8a3, d5ep8b1, d5ep8b3
    automated match to d3h5qa2
    complexed with na, so4

Details for d5ep8b2

PDB Entry: 5ep8 (more details), 2.66 Å

PDB Description: x-ray structure of the complex pyrimidine-nucleoside phosphorylase from bacillus subtilis with sulfate ion
PDB Compounds: (B:) Pyrimidine-nucleoside phosphorylase

SCOPe Domain Sequences for d5ep8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ep8b2 c.27.1.0 (B:71-330) automated matches {Bacillus subtilis [TaxId: 224308]}
lsaiegikvdkhstggvgdtttlvlaplvaaldvpvakmsgrglghtggtidkleaidgf
hveltkrefiklvnrdkvavigqsgnltpadkklyalrdvtgtvnsipliassimskkia
agadaivldvktgagafmkteedaaelakamvrignnvgrqtmavisdmsqplgfaigna
levkeaidtlkgegpedlhelvltlgsqmvvlakkadtldearakleevmkngkalekfk
dflknqggdssivddpsklp

SCOPe Domain Coordinates for d5ep8b2:

Click to download the PDB-style file with coordinates for d5ep8b2.
(The format of our PDB-style files is described here.)

Timeline for d5ep8b2: