Lineage for d5olnb3 (5oln B:331-433)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2945237Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) (S)
  5. 2945255Family d.41.3.0: automated matches [254277] (1 protein)
    not a true family
  6. 2945256Protein automated matches [254643] (6 species)
    not a true protein
  7. 2945257Species Bacillus subtilis [TaxId:224308] [326395] (2 PDB entries)
  8. 2945259Domain d5olnb3: 5oln B:331-433 [351263]
    Other proteins in same PDB: d5olna1, d5olna2, d5olnb1, d5olnb2, d5olnb4
    automated match to d5ep8a3
    complexed with edo, imd, so4

Details for d5olnb3

PDB Entry: 5oln (more details), 1.88 Å

PDB Description: x-ray structure of the complex pyrimidine-nucleoside phosphorylase from bacillus subtilis at 1.88 a
PDB Compounds: (B:) Pyrimidine-nucleoside phosphorylase

SCOPe Domain Sequences for d5olnb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5olnb3 d.41.3.0 (B:331-433) automated matches {Bacillus subtilis [TaxId: 224308]}
qaayqidvpakeagvvseivadeigvaamllgagratkedeidlavgimlrkkvgdkvek
geplvtlyanrenvdeviakvydniriaaeakapklihtlite

SCOPe Domain Coordinates for d5olnb3:

Click to download the PDB-style file with coordinates for d5olnb3.
(The format of our PDB-style files is described here.)

Timeline for d5olnb3: